Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCP3/SYCP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25471325UL
Description
SCP3/SYCP3 Polyclonal specifically detects SCP3/SYCP3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SCP3/SYCP3 | |
Polyclonal | |
Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
MGC71888, SCP3, SCP-3, SCP3 chromosome 3 open reading frame 8, SCP3 COR1, synaptonemal complex protein 3 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
SYCP3 | |
This antibody was developed against a Recombinant Protein corresponding to amino acids:KYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGV | |
25 μL | |
Cell Biology, Cell Cycle and Replication, Chromatin Research, Growth and Development, Neuronal Cell Markers, Neuroscience, Neurotransmission | |
50511 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction