Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCRT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SCRT2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SCRT2 Polyclonal specifically detects SCRT2 in Human samples. It is validated for Western Blot.Specifications
SCRT2 | |
Polyclonal | |
Rabbit | |
NP_149120 | |
85508 | |
Synthetic peptide directed towards the middle region of human SCRT2The immunogen for this antibody is SCRT2. Peptide sequence HMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEPPPPTPAGPAS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
scratch homolog 2, zinc finger protein (Drosophila), transcriptional repressor scratch 2, ZNF898B | |
SCRT2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title