SCUBE2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169603

Catalog No. NBP169603

Description

SCUBE2 Polyclonal specifically detects SCUBE2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SCUBE2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cegb1, Cegf1, CEGP1, FLJ16792, FLJ35234, MGC133057, Protein CEGP1, signal peptide, CUB and EGF-like domain-containing protein 2, signal peptide, CUB domain, EGF-like 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 110 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Mouse: 86%; Zebrafish: 83%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NQ36
• Gene Symbols: SCUBE2
• Immunogen: Synthetic peptides corresponding to SCUBE2(signal peptide, CUB domain, EGF-like 2) The peptide sequence was selected from the C terminal of SCUBE2. Peptide sequence KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57758
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only