SDR16C5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156947

Catalog No. NBP156947

Description

SDR16C5 Polyclonal specifically detects SDR16C5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SDR16C5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 1.1.1.105, EPHD-2, epidermal retinol dehydrogenase 2, FLJ33105, RDH-E2epidermal retinal dehydrogenase 2, RDHE2RDH#2, retinal short chain dehydrogenase reductase, Retinal short-chain dehydrogenase reductase 2, retSDR2, short chain dehydrogenase/reductase family 16C, member 5, Short-chain dehydrogenase/reductase family 16C member 5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Rat, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N3Y7
• Gene Symbols: SDR16C5
• Immunogen: Synthetic peptides corresponding to RDHE2(epidermal retinal dehydrogenase 2) The peptide sequence was selected from the middle region of RDHE2. Peptide sequence AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT.
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 195814
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.