Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SDR16C5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SDR16C5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SDR16C5 Polyclonal specifically detects SDR16C5 in Human samples. It is validated for Western Blot.Specifications
SDR16C5 | |
Polyclonal | |
Rabbit | |
Q8N3Y7 | |
195814 | |
Synthetic peptides corresponding to RDHE2(epidermal retinal dehydrogenase 2) The peptide sequence was selected from the middle region of RDHE2. Peptide sequence AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 1.1.1.105, EPHD-2, epidermal retinol dehydrogenase 2, FLJ33105, RDH-E2epidermal retinal dehydrogenase 2, RDHE2RDH#2, retinal short chain dehydrogenase reductase, Retinal short-chain dehydrogenase reductase 2, retSDR2, short chain dehydrogenase/reductase family 16C, member 5, Short-chain dehydrogenase/reductase family 16C member 5 | |
SDR16C5 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title