SDR42E2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP232346

Catalog No. NBP232346

Description

SDR42E2 Polyclonal specifically detects SDR42E2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SDR42E2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: Putative 3-Beta-HSD Family Protein ENSP00000330812, Putative Short-Chain Dehydrogenase/Reductase Family 42E Member 2, Short Chain Dehydrogenase/Reductase Family 42E, Member 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 100288072
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SDR42E2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VASYGMSGAEKLQKEQIESINVGGTKLVIDVCVR
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only