Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SEC14L3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SEC14L3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SEC14L3 Polyclonal specifically detects SEC14L3 in Rat samples. It is validated for Western Blot.Specifications
SEC14L3 | |
Polyclonal | |
Rabbit | |
Q9Z1J8 | |
266629 | |
Synthetic peptides corresponding to the C terminal of Sec14l3. Immunizing peptide sequence RDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
SEC14-like protein 3, SEC14-like 3 (S. cerevisiae), TAP2 | |
SEC14L3 | |
IgG | |
44 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title