Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SEC14L4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SEC14L4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157591
|
Novus Biologicals
NBP157591 |
100 μL |
Each for $436.00
|
|
NBP1575920
|
Novus Biologicals
NBP15759120UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
SEC14L4 Polyclonal specifically detects SEC14L4 in Human samples. It is validated for Western Blot.Specifications
| SEC14L4 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| dJ130H16.5, SEC14-like 4 (S. cerevisiae), SEC14p-like protein TAP3, TAP3SEC14-like protein 4, Tocopherol-associated protein 3 | |
| SEC14L4 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UDX3 | |
| 284904 | |
| Synthetic peptides corresponding to SEC14L4(SEC14-like 4 (S. cerevisiae)) The peptide sequence was selected from the N terminal of SEC14L4. Peptide sequence MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title