SEC23B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156339

Catalog No. NBP156339

Description

SEC23B Polyclonal antibody specifically detects SEC23B in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: SEC23B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CDAII, CDA-II, CDAN2, congenital dyserythropoietic anemia, type II, HEMPASSec23 (S. cerevisiae) homolog B, protein transport protein Sec23B, Sec23 homolog B (S. cerevisiae), SEC23-like protein B, SEC23-related protein B, transport protein SEC23B
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10483
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q15437
• Gene Symbols: SEC23B
• Immunogen: Synthetic peptides corresponding to SEC23B(Sec23 homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of SEC23B. Peptide sequence SFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPI.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

For Research Use Only