Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SELS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SELS |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SELS Polyclonal specifically detects SELS in Human samples. It is validated for Western Blot.Specifications
SELS | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
55829 | |
Synthetic peptides corresponding to SELS(selenoprotein S) The peptide sequence was selected from the middle region of SELS. Peptide sequence PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ADO15, MGC104346, SBBI8, selenoprotein S, SelS, SEPS1, VCP-interacting membrane protein, VIMPMGC2553 | |
VIMP | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title