Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Semaphorin 6B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP237950
Description
Semaphorin 6B Polyclonal specifically detects Semaphorin 6B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Semaphorin 6B | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Q9H3T3 | |
SEMA6B | |
This antibody was developed against a recombinant protein corresponding to amino acids: AGTVLKFLVRPNASTSGTSGLSVFLEEFETYRPDRCGRPGGGETGQRLLSLELDAASGGLLAAFPRCVVRVPVARCQQYSGCMKNCIG | |
0.1 mL | |
Neuroscience | |
10501 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B, SEMAN, semaphorin VIB, semaphorin Z, semaphorin-6B, semaphorin-6Ba, SEMA-VIB, semaZ, SEM-SEMA-Y, UNQ1907/PRO4353 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction