Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SeP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SeP |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SeP Polyclonal specifically detects SeP in Human samples. It is validated for Western Blot.Specifications
SeP | |
Polyclonal | |
Rabbit | |
selenoprotein P, plasma, 1, SELP | |
Synthetic peptides corresponding to SEPP1(selenoprotein P, plasma, 1) The peptide sequence was selected from the N terminal of SEPP1. Peptide sequence LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
6414 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title