Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Septin-12 Antibody, Novus Biologicals™
SDP

Catalog No. NBP158117 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158117 100 μL
NBP1581720 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP158117 Supplier Novus Biologicals Supplier No. NBP158117
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Septin-12 Polyclonal specifically detects Septin-12 in Human samples. It is validated for Western Blot.

Specifications

Antigen Septin-12
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8IYM1
Gene Alias FLJ25410, septin 12, septin-12
Gene Symbols 43355
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Septin-12. The peptide sequence was selected from the middle region of 40433. Peptide sequence LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 124404
Test Specificity Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 92%; Canine: 92%; Aspergillus clavatus: 91%; Aspergillus nidulans: 91%; Sartorya fumigata: 91%; Aspergillus oryzae: 91%; Wangiella dermatitidis: 91%; Aspergillus nidulans FGSC A4: 91%; Atlantic salmon: 90%; Moniliophthora perniciosa FA553: 90%; Soil fungus: 90%; Green puffer: 90%; Zebrafish: 90%; Xenopus: 84%; Harpegnathos saltator: 84%; Western clawed frog: 84%; Camponotus floridanus: 84%; Yeast: 83%; Neurospora crassa: 83%; Valley fever fungus: 83%; Filobasidiella neoformans: 83%; Glume blotch fungus: 83%; Fission yeast: 83%; Blackleg fungus: 83%; Tunicate: 83%; Pyrenophora teres f. teres 0-1: 83%; Glomerella graminicola M1.001: 83%; Trichoplax reptans: 83%; Podospora anserina: 83%; Paracoccidioides brasiliensis: 83%; Arthroderma gypseum CBS 118893: 83%; Body louse: 76%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.