Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Septin-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP190094
Description
Septin-4 Polyclonal specifically detects Septin-4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Septin-4 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Apoptosis-related protein in the TGF-beta signaling pathway, ARTSPeanut-like protein 2, BRADEION, Bradeion beta, Brain protein H5, CE5B3, Cell division control-related protein 2, Cerebral protein 7, H5, hCDCREL-2SEP4, hucep-7, MART, peanut-like 2, peanut-like 2 (Drosophila), PNUTL2CE5B3 beta, septin 4, septin-4, septin-M | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
SEPTIN4 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:YDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKS | |
0.1 mL | |
Apoptosis | |
5414 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction