Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Septin-6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Septin-6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Septin-6 Polyclonal specifically detects Septin-6 in Human samples. It is validated for Western Blot.Specifications
Septin-6 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication | |
23157 | |
Synthetic peptides corresponding to SEPT6(septin 6) The peptide sequence was selected from the N terminal of 40427. Peptide sequence TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIAA0128SEP2septin 2, MGC16619, MGC20339, SEPT2, septin 6, septin-6 | |
43349 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title