Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SERBP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | SERBP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SERBP1 Polyclonal specifically detects SERBP1 in Human samples. It is validated for Western Blot.Specifications
| SERBP1 | |
| Polyclonal | |
| Rabbit | |
| CGI-55, CHD3IP, chromodomain helicase DNA binding protein 3 interacting protein, DKFZP564M2423, HABP4L, PAI-1 mRNA binding protein, PAI1 RNA-binding protein 1, PAI-RBP1DKFZp564M2423, PAIRBP1FLJ90489, plasminogen activator inhibitor 1 RNA binding protein, plasminogen activator inhibitor 1 RNA-binding protein, SERPINE1 mRNA binding protein 1, SERPINE1 mRNA-binding protein 1 | |
| SERBP1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 26135 | |
| Synthetic peptides corresponding to SERBP1(SERPINE1 mRNA binding protein 1) The peptide sequence was selected from the middle region of SERBP1. Peptide sequence SYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title