Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SERBP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157211
Description
SERBP1 Polyclonal specifically detects SERBP1 in Human samples. It is validated for Western Blot.Specifications
SERBP1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
SERBP1 | |
Synthetic peptides corresponding to SERBP1(SERPINE1 mRNA binding protein 1) The peptide sequence was selected from the middle region of SERBP1. Peptide sequence SYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDE. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Chicken: 92%; Xenopus: 85%; Zebrafish: 85%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
CGI-55, CHD3IP, chromodomain helicase DNA binding protein 3 interacting protein, DKFZP564M2423, HABP4L, PAI-1 mRNA binding protein, PAI1 RNA-binding protein 1, PAI-RBP1DKFZp564M2423, PAIRBP1FLJ90489, plasminogen activator inhibitor 1 RNA binding protein, plasminogen activator inhibitor 1 RNA-binding protein, SERPINE1 mRNA binding protein 1, SERPINE1 mRNA-binding protein 1 | |
Rabbit | |
Affinity purified | |
RUO | |
26135 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction