Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP159203

SERCA2 ATPase Antibody, Novus Biologicals™
SDP

Catalog No. NBP159203 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159203 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159203 Supplier Novus Biologicals Supplier No. NBP159203
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SERCA2 ATPase Polyclonal antibody specifically detects SERCA2 ATPase in Human, Mouse, Monkey samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

Antigen SERCA2 ATPase
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P16615
Gene Alias ATP2BFLJ20293, ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2, Calcium pump 2, Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletalmuscle isoform, cardiac Ca2+ ATPase, DAR, DD, EC 3.6.3, EC 3.6.3.8, Endoplasmic reticulum class 1/2 Ca(2+) ATPase, FLJ38063, MGC45367, sarcoplasmic/endoplasmic reticulum calcium ATPase 2, SERCA2DKFZp686P0211, SR Ca(2+)-ATPase 2
Gene Symbols ATP2A2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ATP2A2(ATPase, Ca++ transporting, cardiac muscle, slow twitch 2) The peptide sequence was selected from the C terminal of ATP2A2. Peptide sequence VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV.
Molecular Weight of Antigen 115 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 488
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Monkey, Bovine, Canine, Equine, Guinea Pig, Rabbit, Rhesus Macaque, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.