Invitrogen™ SERCA3 ATPase Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578838

Catalog No. PIPA578838

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Skeletal Muscle Tissue, Mouse Skeletal Muscle Tissue. IHC: Mouse Thymus Tissue, Rat Thymus Tissue.

ATP dependent calcium pumps are responsible in part for the maintenance of low cytoplasmic free calcium concentrations. The ATP pumps that reside in intracellular organelles are encoded by a family of structurally related enzymes, termed the sarcoplasmic or endoplasmic reticulum calcium ATPases (SERCA). The SERCA2 gene is subject to tissue dependent processing which is responsible for the generation of SERCA2a muscle-specific isoform expressed in type I (slow) skeletal, cardiac and smooth muscle and the SERCA2b isoform expressed in all cell types. SERCA3 has been found to co-express with SERCA2b in platelets, mast cells, lymphoid cells, and epithelial cells. Due to this pattern of expression it is referred to as the non-muscle form of SERCA.

Specifications

• Antigen: SERCA3 ATPase
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Atp2a3
• Gene Alias: adenosine triphosphatase, calcium; ATP2A3; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3; ATPase, Ca(2+)-transporting, ubiquitous; ATPase, Ca++ transporting, ubiquitous; calcium pump 3; calcium-translocating P-type ATPase; sarco/endoplasmic reticulum Ca2+ -ATPase; sarcoendoplasmic reticulum Ca2+ ATPase type 3; sarcoplasmic/endoplasmic reticulum calcium ATPase 3; SERCA3; SERCA3b; SR Ca(2+)-ATPase 3
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 25391, 489, 53313
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P18596, Q64518, Q93084
• Gene Symbols: Atp2a3
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3 (1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG