Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Serpin A5/Protein C Inhibitor Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317021100UL
This item is not returnable.
View return policy
Description
Serpin A5/Protein C Inhibitor Polyclonal antibody specifically detects Serpin A5/Protein C Inhibitor in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
Serpin A5/Protein C Inhibitor | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Acrosomal serine protease inhibitor, antitrypsin), member 5, member 5, PAI-3, PAI3PLANH3, PCIplasminogen activator inhibitor III, Plasminogen activator inhibitor 3, plasminogen activator inhibitor-3, PROCIplasma serine protease inhibitor, Protein C inhibitor, serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, Serpin A5, serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), SERPNA5 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: KWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNAT | |
100 μg | |
Cancer | |
5104 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction