Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SERPINB13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25722525UL
Description
SERPINB13 Polyclonal specifically detects SERPINB13 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
SERPINB13 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
HaCaT UV-repressible serpin, Headpin, HSHUR7SEQ, HUR7, HURPIN, MGC126870, Peptidase inhibitor 13, PI-13, PI13hurpin, protease inhibitor 13 (hurpin, headpin), Proteinase inhibitor 13, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 13, serpin B13, serpin peptidase inhibitor, clade B (ovalbumin), member 13, UV-B repressed sequence, HUR 7 | |
Rabbit | |
Affinity Purified | |
RUO | |
5275 | |
Human | |
Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
SERPINB13 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RGATASQLEEVFHSEKETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLF | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction