SerpinB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325132

Catalog No. NB301320

Description

SerpinB2 Polyclonal antibody specifically detects SerpinB2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SerpinB2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: HsT1201, Monocyte Arg-serpin, PAI, PAI2Urokinase inhibitor, Placental plasminogen activator inhibitor, PLANH2PAI-2, plasminogen activator inhibitor 2, plasminogen activator inhibitor, type II (arginine-serpin), serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 2, Serpin B2, serpin peptidase inhibitor, clade B (ovalbumin), member 2
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein SerpinB2 using the following amino acid sequence: DEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNE
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cancer
• Gene ID (Entrez): 5055
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified