Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Seryl tRNA synthetase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Seryl tRNA synthetase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
Seryl tRNA synthetase Polyclonal specifically detects Seryl tRNA synthetase in Human samples. It is validated for Western Blot.Specifications
| Seryl tRNA synthetase | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q5T5C8 | |
| 6301 | |
| Synthetic peptides corresponding to SARS (seryl-tRNA synthetase) The peptide sequence was selected from the C terminal of SARS. Peptide sequence PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| EC 6.1.1.11, FLJ36399, serine-tRNA ligase, Serine--tRNA ligase, SERRS, SERSserine tRNA ligase 1, cytoplasmic, Seryl-tRNA Ser/Sec synthetase, seryl-tRNA synthetase, seryl-tRNA synthetase, cytoplasmic, Seryl-tRNA(Ser/Sec) synthetase | |
| SARS | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title