Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Seryl tRNA synthetase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP255884
Description
Seryl tRNA synthetase Polyclonal specifically detects Seryl tRNA synthetase in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Seryl tRNA synthetase | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
EC 6.1.1.11, FLJ36399, serine-tRNA ligase, Serine--tRNA ligase, SERRS, SERSserine tRNA ligase 1, cytoplasmic, Seryl-tRNA Ser/Sec synthetase, seryl-tRNA synthetase, seryl-tRNA synthetase, cytoplasmic, Seryl-tRNA(Ser/Sec) synthetase | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
SARS | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQ | |
100 μL | |
Core ESC Like Genes, Stem Cell Markers | |
6301 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction