Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SET Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | SET |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SET Polyclonal specifically detects SET in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SET | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q01105 | |
| 6418 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEID | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 2PP2A, HLA-DR-associated protein II, I2PP2A, I-2PP2A, IGAAD, Inhibitor of granzyme A-activated DNase, inhibitor-2 of protein phosphatase-2A, IPP2A2, PHAPIITAF-I, Phosphatase 2A inhibitor I2PP2A, protein phosphatase type 2A inhibitor, protein SET, SET nuclear oncogene, SET translocation (myeloid leukemia-associated), TAF-IBETA, Template-activating factor I, Template-Activating Factor-I, chromatin remodelling factor | |
| SET | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title