SETD1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24928125UL

Catalog No. NB395765

Description

SETD1A Polyclonal antibody specifically detects SETD1A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SETD1A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: histone-lysine N-methyltransferase SETD1A, hSET1A, KIAA0339EC 2.1.1.43, KMT2FSET1, Lysine N-methyltransferase 2F, SET domain containing 1A, SET domain-containing protein 1A, Set1, Set1/Ash2 histone methyltransferase complex subunit SET1, SET1A
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SQFRSSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRPTDQDYRPPASEA
• Quantity: 25 μL
• Research Discipline: DNA Repair
• Gene ID (Entrez): 9739
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified