Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SETD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SETD3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SETD3 Polyclonal specifically detects SETD3 in Human samples. It is validated for Western Blot.Specifications
SETD3 | |
Polyclonal | |
Rabbit | |
Human | |
C14orf154, chromosome 14 open reading frame 154, DKFZp761E1415, EC 2.1.1.43, FLJ23027, MGC87236, SET domain containing 3, SET domain-containing protein 3 | |
SETD3 | |
IgG | |
34 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_954574 | |
84193 | |
Synthetic peptide directed towards the middle region of human SETD3The immunogen for this antibody is SETD3. Peptide sequence AVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLTPEDSFALAVASA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title