Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SETD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | SETD3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179446
|
Novus Biologicals
NBP179446 |
100 μL |
Each of 1 for $436.00
|
|
Description
SETD3 Polyclonal specifically detects SETD3 in Human samples. It is validated for Western Blot.Specifications
SETD3 | |
Polyclonal | |
Rabbit | |
Human | |
NP_954574 | |
84193 | |
Synthetic peptide directed towards the middle region of human SETD3The immunogen for this antibody is SETD3. Peptide sequence AVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLTPEDSFALAVASA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C14orf154, chromosome 14 open reading frame 154, DKFZp761E1415, EC 2.1.1.43, FLJ23027, MGC87236, SET domain containing 3, SET domain-containing protein 3 | |
SETD3 | |
IgG | |
Affinity Purified | |
34 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title