Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SETD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	SETD4
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP18004620 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP18004620UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP180046 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP180046	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SETD4 Polyclonal specifically detects SETD4 in Human samples. It is validated for Western Blot.

Specifications

Antigen	SETD4
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_059134
Gene ID (Entrez)	54093
Immunogen	Synthetic peptide directed towards the C terminal of human C21ORF18. Peptide sequence LTALKLLCLEAEKFTCWKKVLLGEVISDTNEKTSLDIAQKICYYFIEETN.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	C21orf18, C21orf27, chromosome 21 open reading frame 18, chromosome 21 open reading frame 27, SET domain containing 4, SET domain-containing protein 4
Gene Symbols	SETD4
Isotype	IgG
Molecular Weight of Antigen	50 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SETD4 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents