SETD9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156742

Catalog No. NBP156742

Description

SETD9 Polyclonal specifically detects SETD9 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C5orf35
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C5orf35, chromosome 5 open reading frame 35, hypothetical protein LOC133383, MGC33648, SET domain containing 9
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 133383
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NE22
• Gene Symbols: SETD9
• Immunogen: Synthetic peptides corresponding to C5ORF35 The peptide sequence was selected from the N terminal of C5ORF35. Peptide sequence QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: White-tufted-ear marmoset: 92%; Human: 100%; Sumatran orangutan: 92%; Dusky titi monkey: 92%; Vibrio cholerae 2740-80: 90%; Vibrio cholerae: 90%; Vibrio cholerae MAK 757: 90%; Vibrio cholerae INDRE 91/1: 90%; Vibrio cholerae RC27: 90%; Vibrio cholerae MO10: 90%; Vibrio cholerae BX 330286: 90%; Vibrio cholerae RC9: 90%; Vibrio cholerae B33: 90%; Vibrio cholerae NCTC 8457: 90%; Vibrio cholerae CIRS101: 90%; Olive baboon: 85%;.
• Target Species: Human
• Isotype: IgG