Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SETD9 Antibody, Novus Biologicals™

SETD9 Antibody, Novus Biologicals™
SDP

Catalog No. NBP156742 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156742 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156742 Supplier Novus Biologicals Supplier No. NBP156742
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SETD9 Polyclonal specifically detects SETD9 in Human samples. It is validated for Western Blot.

Specifications

Antigen C5orf35
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8NE22
Gene Alias C5orf35, chromosome 5 open reading frame 35, hypothetical protein LOC133383, MGC33648, SET domain containing 9
Gene Symbols SETD9
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C5ORF35 The peptide sequence was selected from the N terminal of C5ORF35. Peptide sequence QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 133383
Test Specificity Expected identity based on immunogen sequence: White-tufted-ear marmoset: 92%; Human: 100%; Sumatran orangutan: 92%; Dusky titi monkey: 92%; Vibrio cholerae 2740-80: 90%; Vibrio cholerae: 90%; Vibrio cholerae MAK 757: 90%; Vibrio cholerae INDRE 91/1: 90%; Vibrio cholerae RC27: 90%; Vibrio cholerae MO10: 90%; Vibrio cholerae BX 330286: 90%; Vibrio cholerae RC9: 90%; Vibrio cholerae B33: 90%; Vibrio cholerae NCTC 8457: 90%; Vibrio cholerae CIRS101: 90%; Olive baboon: 85%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.