Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SF-1/NR5A1/Steroidogenic Factor 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP32141825UL
Description
SF-1/NR5A1/Steroidogenic Factor 1 Polyclonal antibody specifically detects SF-1/NR5A1/Steroidogenic Factor 1 in Human samples. It is validated for ImmunofluorescenceSpecifications
SF-1/NR5A1/Steroidogenic Factor 1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
AD4BPSTF-1, Adrenal 4-binding protein, ELP, FTZ1adrenal 4 binding protein, FTZF1nuclear receptor AdBP4, Fushi tarazu factor homolog 1, Nuclear receptor subfamily 5 group A member 1, nuclear receptor subfamily 5, group A, member 1, SF-1POF7, SF1steroidogenic factor 1, Steroid hormone receptor Ad4BP, steroidogenic factor-1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: VPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQT | |
25 μg | |
Cell Biology | |
2516 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction