Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SF3A2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | SF3A2 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB124787
|
Novus Biologicals
NBP309943100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
SF3A2 Polyclonal specifically detects SF3A2 in Human samples. It is validated for Western Blot.Specifications
SF3A2 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
pre-mRNA splicing factor SF3A, subunit 2, PRP11, PRPF11, SAP 62, SAP62Prp11, SF3a66splicing factor 3a, subunit 2, 66kD, spliceosome associated protein 62, Spliceosome-associated protein 62, splicing factor 3A subunit 2, splicing factor 3a, subunit 2, 66kDa | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SF3A2. Peptide sequence GGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECK | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
8175 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title