Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SF4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SF4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157563
|
Novus Biologicals
NBP157563 |
100 μL |
Each for $436.00
|
|
NBP15756320
|
Novus Biologicals
NBP15756320UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
SF4 Polyclonal specifically detects SF4 in Human samples. It is validated for Western Blot.Specifications
| SF4 | |
| Polyclonal | |
| Rabbit | |
| Q8IWZ8 | |
| 57794 | |
| Synthetic peptides corresponding to SF4(splicing factor 4) The peptide sequence was selected from the N terminal of SF4. Peptide sequence MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp434E2216, F23858, SF4RNA-binding protein RBP, Splicing factor 4RBP, SURP and G patch domain containing 1, SURP and G-patch domain-containing protein 1 | |
| SUGP1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title