Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SF4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SF4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SF4 Polyclonal specifically detects SF4 in Human samples. It is validated for Western Blot.Specifications
SF4 | |
Polyclonal | |
Rabbit | |
Q8IWZ8 | |
57794 | |
Synthetic peptides corresponding to SF4(splicing factor 4) The peptide sequence was selected from the N terminal of SF4. Peptide sequence MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp434E2216, F23858, SF4RNA-binding protein RBP, Splicing factor 4RBP, SURP and G patch domain containing 1, SURP and G-patch domain-containing protein 1 | |
SUGP1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title