Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SF4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen SF4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157563
View Documents
Novus Biologicals
NBP157563
100 μL
Each for $436.00
Add to cart
 
NBP15756320
View Documents
Novus Biologicals
NBP15756320UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

SF4 Polyclonal specifically detects SF4 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SF4
Polyclonal
Rabbit
Q8IWZ8
57794
Synthetic peptides corresponding to SF4(splicing factor 4) The peptide sequence was selected from the N terminal of SF4. Peptide sequence MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
DKFZp434E2216, F23858, SF4RNA-binding protein RBP, Splicing factor 4RBP, SURP and G patch domain containing 1, SURP and G-patch domain-containing protein 1
SUGP1
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit