SFPQ Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157303

Catalog No. NBP157303

Description

SFPQ Polyclonal specifically detects SFPQ in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SFPQ
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 100 kDa DNA-pairing protein, DNA-binding p52/p100 complex, 100 kDa subunit, hPOMp100, polypyrimidine tract binding protein associated, polypyrimidine tract-binding protein-associated splicing factor, Polypyrimidine tract-binding protein-associated-splicing factor, PSFPOMP100, PTB-associated splicing factor, PTB-associated-splicing factor, splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated), splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated), splicing factor proline/glutamine-rich, splicing factor, proline- and glutamine-rich
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P23246
• Gene Symbols: SFPQ
• Immunogen: Synthetic peptides corresponding to SFPQ(splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated)) The peptide sequence was selected from the middle region of SFPQ. Peptide sequence PVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQR The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 6421
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only