Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SFRS12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SFRS12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SFRS12 Polyclonal specifically detects SFRS12 in Human samples. It is validated for Western Blot.Specifications
SFRS12 | |
Polyclonal | |
Rabbit | |
Q8WXA9-2 | |
140890 | |
Synthetic peptides corresponding to SFRS12(splicing factor, arginine/serine-rich 12) The peptide sequence was selected from the N terminal of SFRS12. Peptide sequence DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp564B176, Serine/arginine-rich-splicing regulatory protein 86, SFRS12serine-arginine-rich-splicing regulatory protein 86, Splicing factor, arginine/serine-rich 12MGC133045, splicing regulatory glutamine/lysine-rich protein 1, Splicing regulatory protein 508, SRRp508, SRrp508SRrp86serine-arginine-rich splicing regulatory protein 508, SRRP86 | |
SREK1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title