SFRS9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157465

Catalog No. NBP157465

Description

SFRS9 Polyclonal specifically detects SFRS9 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: SFRS9
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Pre-mRNA-splicing factor SRp30C, serine/arginine-rich splicing factor 9, SFRS9, Splicing factor, arginine/serine-rich 9SR splicing factor 9, SRp30c
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8683
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Accession No.: Q13242
• Gene Symbols: SRSF9
• Immunogen: Synthetic peptides corresponding to SFRS9(splicing factor, arginine/serine-rich 9) The peptide sequence was selected from the middle region of SFRS9. Peptide sequence VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Caenorhabditis briggsae AF16: 100%; Caenorhabditis elegans: 100%; Western clawed frog: 100%; Xenopus: 100%; Rat: 100%; Mouse: 100%; Caenorhabditis vulgaris: 100%; Canine: 100%; Human: 100%; Zebrafish: 92%; Chicken: 92%; Sumatran orangutan: 92%; Green puffer: 92%; Pig: 92%; Eye worm: 92%; Atlantic salmon: 92%; Filarial nematode worm: 92%; Bovine: 92%; Trichoplax reptans: 91%; Florida lancelet: 90%; Starlet sea anemone: 85%; Blood fluke: 85%; Pea aphid: 85%; Yellowfever mosquito: 84%; Camponotus floridanus: 84%; Body louse: 84%; Savannah tsetse fly: 84%; Red flour beetle: 84%; Black-legged tick: 84%; Fruit fly: 84%; Southern house mosquito: 84%; Midge: 84%; Harpegnathos saltator: 81%; African malaria mosquito: 81%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only