Invitrogen™ SFTPA1/SFTPA2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579987

Catalog No. PIPA579987

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat lung tissue, mouse lung tissue. IHC: Mouse Lung tissue, Rat Lung tissue, Human Lung Cancer tissue IHC-F: Mouse Lung tissue, Rat Lung tissue.

Surfactant protein A (SP-A) is synthesized and secreted by lung epithelial cells. It belongs to group III of the family of C-type lectins and members of this group has overall structure consisting of multiple globular 'head' regions linked by triple-helical, collagen-like, strands. This group also includes SP-D and the serum proteins mannan-binding protein, conglutinin and collectin-43, all of which have been shown to bind to the C1q receptor found on a wide variety of cells. Both SP-D and SP-A have been shown to enhance oxygen radical production by alveolar macrophages. The serum concentration is 45 ng/mL in healthy individuals.

Specifications

• Antigen: SFTPA1/SFTPA2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Sftpa1
• Gene Alias: 35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; COLEC4; COLEC5; collectin 5; collectin-4; Collectin-5; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590; PSAP; PSPA; PSP-A; pulmonary surfactant-associated protein A; Pulmonary surfactant-associated protein A1; pulmonary surfactant-associated protein A2; Sftp1; Sftp-1; Sftpa; Sftpa1; SFTPA1B; SFTPA2; SFTPA2B; Sftpl; SP-2A; SP-2A beta; SP-2A gamma; SPA; SP-A; SPA1; SP-A1; SP-A1 beta; SP-A1 delta; SP-A1 epsilon; SP-A1 gamma; SPA2; SP-A2; SP-A2 alpha; SP-A2 delta; SPAII; surfactant associated protein A; surfactant associated protein A1; surfactant protein A1; surfactant protein A1 variant AB'D' 6A; surfactant protein A1 variant AB'D' 6A2; surfactant protein A1 variant AB'D' 6A3; surfactant protein A1 variant AB'D' 6A4; surfactant protein A1 variant ACD' 6A; surfactant protein A1 variant ACD' 6A2; surfactant protein A1 variant ACD' 6A3; surfactant protein A1 variant ACD' 6A4; surfactant protein A1 variant AD' 6A; surfactant protein A1 variant AD' 6A2; surfactant protein A1 variant AD' 6A3; surfactant protein A1 variant AD' 6A4; surfactant protein A1B; surfactant protein A2; surfactant pulmonary associated protein A1; surfactant, pulmonary-associated protein A1; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; surfactant, pulmonary-associated protein A2A; Surfactant-associated protein 1 (pulmonary surfactant protein SP-A); Surfactant-associated protein 1 (pulmonary surfactant protein, SP-A)
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 20387, 24773, 653509, 729238
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P08427, P35242, Q8IWL1, Q8IWL2
• Gene Symbols: Sftpa1, SFTPA2
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2 (206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov