Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SFXN1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SFXN1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SFXN1 Polyclonal specifically detects SFXN1 in Human samples. It is validated for Western Blot.Specifications
SFXN1 | |
Polyclonal | |
Rabbit | |
Q9H9B4 | |
94081 | |
Synthetic peptides corresponding to SFXN1(sideroflexin 1) The peptide sequence was selected from the N terminal of SFXN1. Peptide sequence MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKI. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ12876, sideroflexin 1, sideroflexin-1, TCC, Tricarboxylate carrier protein | |
SFXN1 | |
IgG | |
35 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title