Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SGLT1/SLC5A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23362925UL
Description
SGLT1/SLC5A1 Polyclonal specifically detects SGLT1/SLC5A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SGLT1/SLC5A1 | |
Polyclonal | |
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
P13866 | |
SLC5A1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: DLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWR | |
25 μL | |
Membrane Trafficking and Chaperones | |
6523 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
D22S675, High affinity sodium-glucose cotransporter, Na+/glucose cotransporter 1, NAGTsodium/glucose cotransporter 1, SGLT1Na(+)/glucose cotransporter 1, solute carrier family 5 (sodium/glucose cotransporter), member 1, Solute carrier family 5 member 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction