Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SGLT1/SLC5A1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP238748 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238748 0.1 mL
NB404642 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP238748 Supplier Novus Biologicals Supplier No. NBP238748
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SGLT1/SLC5A1 Polyclonal specifically detects SGLT1/SLC5A1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen SGLT1/SLC5A1
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P13866
Gene Alias D22S675, High affinity sodium-glucose cotransporter, Na+/glucose cotransporter 1, NAGTsodium/glucose cotransporter 1, SGLT1Na(+)/glucose cotransporter 1, solute carrier family 5 (sodium/glucose cotransporter), member 1, Solute carrier family 5 member 1
Gene Symbols SLC5A1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: HEVGGYDAFMEKYMKAIPTIVSDGNTTFQEKCYTPRAD
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Membrane Trafficking and Chaperones
Primary or Secondary Primary
Gene ID (Entrez) 6523
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.