SGLT3/SLC5A4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159886

Catalog No. NBP159886

Description

SGLT3/SLC5A4 Polyclonal specifically detects SGLT3/SLC5A4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SGLT3/SLC5A4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DJ90G24.4, low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 3, SAAT1low affinity sodium glucose cotransporter, SGLT2, SGLT3, sodium transporter, Sodium/glucose cotransporter 3, solute carrier family 5 (low affinity glucose cotransporter), member 4, solute carrier family 5 (neutral amino acid transporters, system A), member 4, Solute carrier family 5 member 4
• Host Species: Rabbit
• Molecular Weight of Antigen: 72 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Dusky titi monkey: 84%;.
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NY91
• Gene Symbols: SLC5A4
• Immunogen: Synthetic peptides corresponding to SLC5A4(solute carrier family 5 (low affinity glucose cotransporter), member 4) (NP_055042). The peptide sequence was selected from the N terminal of SLC5A4. Peptide sequence MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6527
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only