SH3BP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158872

Catalog No. NBP158872

Description

SH3BP2 Polyclonal specifically detects SH3BP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SH3BP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Abl-SH3 binding protein 2, Cherubism, CRBM, CRPM, FLJ42079, FLJ54978,3BP-2,3BP2, RES4-23, SH3 domain-binding protein 2, SH3-domain binding protein 2, TNFAIP3 interacting protein 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Guinea pig: 92%; Rabbit: 92%; Bovine: 84%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P78314
• Gene Symbols: SH3BP2
• Immunogen: Synthetic peptides corresponding to SH3BP2(SH3-domain binding protein 2) The peptide sequence was selected from the middle region of SH3BP2. Peptide sequence RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ.
• Quantity: 100 μL
• Research Discipline: Cell Biology, Signal Transduction
• Gene ID (Entrez): 6452
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only