SH3D19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25624625UL

Catalog No. NB394577

Description

SH3D19 Polyclonal specifically detects SH3D19 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SH3D19
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: ADAM binding protein Eve-1, ADAM-binding protein Eve-1, DKFZp434D0215, EBPMGC118912, EEN binding protein, EEN-binding protein, EVE1, Kryn, MGC105136, MGC118910, MGC118911, MGC118913, SH3 domain containing 19, SH3 domain protein D19, SH3 domain-containing protein 19, SH3P19
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 152503
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SH3D19
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAEESVGSEMVLDPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLPAEKPIGNTFSTVSGKLSN
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only