Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SH3D19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP256246
Description
SH3D19 Polyclonal specifically detects SH3D19 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
SH3D19 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
ADAM binding protein Eve-1, ADAM-binding protein Eve-1, DKFZp434D0215, EBPMGC118912, EEN binding protein, EEN-binding protein, EVE1, Kryn, MGC105136, MGC118910, MGC118911, MGC118913, SH3 domain containing 19, SH3 domain protein D19, SH3 domain-containing protein 19, SH3P19 | |
Rabbit | |
Affinity Purified | |
RUO | |
152503 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
SH3D19 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAEESVGSEMVLDPFQLPAKTEPIKERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLPAEKPIGNTFSTVSGKLSN | |
100 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction