Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SH3GL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SH3GL3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SH3GL3 Polyclonal specifically detects SH3GL3 in Human, Mouse samples. It is validated for Western Blot.Specifications
SH3GL3 | |
Polyclonal | |
Rabbit | |
NP_059096 | |
6457 | |
Synthetic peptide directed towards the middle region of human Sh3gl3The immunogen for this antibody is Sh3gl3. Peptide sequence IDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CNSA3, EEN-B2, endophilin-A3, SH3D2C, SH3-domain GRB2-like 3 | |
SH3GL3 | |
IgG | |
38 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title