SHIP2/INPPL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Catalog Number	Mfr. No.	Quantity
NB418555	Novus Biologicals NBP18704625UL	25 μL
NBP187046	Novus Biologicals NBP187046	0.1 mL

Description

SHIP2/INPPL1 Polyclonal specifically detects SHIP2/INPPL1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SHIP2/INPPL1
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Immune System Diseases, Immunology, Innate Immunity
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 3636
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TLGELIGLYAQPNQGLVCALLLPVEGEREPDPPDDRDASDGEDEKPPLPPRSGSTSISAPTGPSSPLPAPETPTAPAAESAPNGLST
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: EC 3.1.3, EC 3.1.3.n1, inositol polyphosphate phosphatase-like 1, Inositol polyphosphate phosphatase-like protein 1, INPPL-1, phosphatidylinositol-34,5-trisphosphate 5-phosphatase 2, Protein 51C, SH2 domain-containing inositol phosphatase 2, SH2 domain-containing inositol-5'-phosphatase 2, SHIP-2, SHIP251C protein
• Gene Symbols: INPPL1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only