Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SHMT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | SHMT1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP153192
|
Novus Biologicals
NBP153192 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15319220
|
Novus Biologicals
NBP15319220UL |
20 μL | N/A | N/A | N/A | ||||
Description
SHMT1 Polyclonal specifically detects SHMT1 in Human samples. It is validated for Western Blot.Specifications
| SHMT1 | |
| Polyclonal | |
| Rabbit | |
| 14 kDa protein, CSHMT, cytoplasmic serine hydroxymethyltransferase, Glycine hydroxymethyltransferase, MGC15229, MGC24556, serine hydroxymethyltransferase 1 (soluble), serine hydroxymethyltransferase, cytosolic, Serine methylase, SHMTEC 2.1.2.1 | |
| SHMT1 | |
| IgG | |
| 53 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 6470 | |
| Synthetic peptides corresponding to SHMT1 (serine hydroxymethyltransferase 1 (soluble)) The peptide sequence was selected from the N terminal of SHMT1)(50ug). Peptide sequence NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title