Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SHMT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | SHMT1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15319220
|
Novus Biologicals
NBP15319220UL |
20 μL |
Each for $204.00
|
|
|||||
NBP153192
|
Novus Biologicals
NBP153192 |
100 μL |
Each for $482.50
|
|
|||||
Description
SHMT1 Polyclonal specifically detects SHMT1 in Human samples. It is validated for Western Blot.Specifications
SHMT1 | |
Polyclonal | |
Rabbit | |
14 kDa protein, CSHMT, cytoplasmic serine hydroxymethyltransferase, Glycine hydroxymethyltransferase, MGC15229, MGC24556, serine hydroxymethyltransferase 1 (soluble), serine hydroxymethyltransferase, cytosolic, Serine methylase, SHMTEC 2.1.2.1 | |
SHMT1 | |
IgG | |
53 kDa |
Western Blot | |
Unconjugated | |
RUO | |
6470 | |
Synthetic peptides corresponding to SHMT1 (serine hydroxymethyltransferase 1 (soluble)) The peptide sequence was selected from the N terminal of SHMT1)(50ug). Peptide sequence NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title