Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SHOX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP255181
Description
SHOX Polyclonal specifically detects SHOX in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
SHOX | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
GCFXX-linked, PHOGShort stature homeobox-containing protein, Pseudoautosomal homeobox-containing osteogenic protein, short stature homeobox, short stature homeobox protein, SHOXY | |
Rabbit | |
Affinity Purified | |
RUO | |
6473 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
SHOX | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDITEGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYEC | |
100 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction