Novus Biologicals™ Shugoshin Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Shugoshin. Source: E.coli Amino Acid Sequence: TASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETH The Shugoshin Recombinant Protein Antigen is derived from E. coli. The Shugoshin Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 151648
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: Shugoshin Recombinant Protein Antigen
• Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: FLJ14230, hSgo1, NY-BR-85, Serologically defined breast cancer antigen NY-BR-85, SGO, SGO1, shugoshin 1AB protein, shugoshin 1CD protein, shugoshin 1EF protein, shugoshin 1GH protein, shugoshin 1KL protein, shugoshin-like 1, shugoshin-like 1 (S. pombe)
• Gene Symbol: SGO1
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.Coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50815. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only